PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc002970.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family ZF-HD
Protein Properties Length: 142aa    MW: 15650.6 Da    PI: 7.4638
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc002970.1_g00007.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer78.68.3e-254489450
              ZF-HD_dimer  4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHR 50
                             +rY+eClkNhAas+Ggh+v GCg fmps geegt +alkC AC+CH 
  Itr_sc002970.1_g00007.1 44 IRYRECLKNHAASTGGHVVNGCGKFMPS-GEEGTLEALKCVACNCHS 89
                             79*************************9.999**************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047703.0E-234488IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-164495IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015669.6E-234589IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152322.5684695IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466893.94E-5106142IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-11111142IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    Send to blast
MHEGPSNPDP DPDPDPDLSL LNNKATTQQV LPQRFVDTDP TTLIRYRECL KNHAASTGGH  60
VVNGCGKFMP SGEEGTLEAL KCVACNCHSK GIRPESSSED LNAGGGQGLM QVLSSKKRFR  120
TKFTQQQKQQ MHEFAEKIGW RI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002886165.13e-36ATHB24
SwissprotQ9ZPW73e-32ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLD7LBB23e-36D7LBB2_ARALL; ATHB24
STRINGscaffold_304185.19e-36(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11052486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.14e-23homeobox protein 24